mevalonate kinase, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-207	50 μL

Catalog No. 89-004-207 Supplier Abnova Corporation Supplier No. H00004598A01

Description

Mouse polyclonal antibody raised against a partial recombinant MVK.

This gene encodes the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobulinaemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestinal dismay and skin rash. Two transcript variants that encode the same protein have been found for this gene. [provided by RefSeq

Sequence: LIDMNQHHLNALGVGHASLDQLCQVTRARGLHSKLTGAGGGGCGITLLKPGLEQPEVEATKQALTSCGFDCLETSIGAPGVSIHSATSLDSRVQQALDGL

Specifications

• Antigen: mevalonate kinase
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MVK.
• Formulation: 50% glycerol
• Gene: MVK
• Gene Accession No.: BC016140
• Gene Alias: FLJ96772/LRBP/MK/MVLK
• Gene Symbols: MVK
• Host Species: Mouse
• Immunogen: MVK (AAH16140, 297 a.a. ∼ 396 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4598
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum