Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89016854

NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No. 89016854 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-854 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-854 Supplier Abnova Corporation Supplier No. H00004716B01P
Only null left
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a full-length human NDUFB10 protein.

Sequence: MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS

Specifications

Antigen NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human NDUFB10 protein.
Formulation PBS with no preservative; pH 7.4
Gene NDUFB10
Gene Accession No. NM_004548.1
Gene Alias PDSW
Gene Symbols NDUFB10
Host Species Mouse
Immunogen NDUFB10 (NP_004539.1, 1 a.a. ∼ 172 a.a) full-length human protein.
Purification Method Affinity Purified
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4716
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.