nudix (nucleoside diphosphate linked moiety X)-type motif 1, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-017-868	100 μg

Catalog No. 89-017-868 Supplier Abnova Corporation Supplier No. H00004521D01P

Description

Rabbit polyclonal antibody raised against a full-length human NUDT1 protein.

Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described. [provided by RefSeq

Sequence: MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Specifications

• Antigen: nudix (nucleoside diphosphate linked moiety X)-type motif 1
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human NUDT1 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NUDT1
• Gene Accession No.: NM_002452
• Gene Alias: MTH1
• Gene Symbols: NUDT1
• Host Species: Rabbit
• Immunogen: NUDT1 (NP_002443.3, 1 a.a. ∼ 156 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Stem Cell Biology
• Primary or Secondary: Primary
• Gene ID (Entrez): 4521
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG