paired box 7, Mouse, Clone: 1E12, Abnova™

Catalog No.	Quantity
89-000-860	100 μg

Catalog No. 89-000-860 Supplier Abnova Corporation Supplier No. H00005081M05

Description

Mouse monoclonal antibody raised against a partial recombinant PAX7.

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT

Specifications

• Antigen: paired box 7
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 1E12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PAX7.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PAX7
• Gene Accession No.: NM_002584
• Gene Alias: HUP1/PAX7B
• Gene Symbols: PAX7
• Host Species: Mouse
• Immunogen: PAX7 (NP_002575.1, 411 a.a. ∼ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5081
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ