programmed cell death 6 interacting protein, Mouse, Clone: 3C4, Abnova™

Catalog No.	Quantity
89-014-249	100 μg

Catalog No. 89-014-249 Supplier Abnova Corporation Supplier No. H00010015M01

Description

Mouse monoclonal antibody raised against a partial recombinant PDCD6IP.

This gene encodes a protein thought to participate in programmed cell death. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVK

Specifications

• Antigen: programmed cell death 6 interacting protein
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 3C4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PDCD6IP.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PDCD6IP
• Gene Accession No.: BC020066
• Gene Alias: AIP1/Alix/DRIP4/HP95/MGC17003
• Gene Symbols: PDCD6IP
• Host Species: Mouse
• Immunogen: PDCD6IP (AAH20066, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Gene ID (Entrez): 10015
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ