programmed cell death 6 interacting protein, Mouse, Clone: 3C4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PDCD6IP.

Supplier:  Abnova Corporation H00010015M01

Catalog No. 89-014-249

Description

This gene encodes a protein thought to participate in programmed cell death. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVK

Specifications

• Antigen: programmed cell death 6 interacting protein
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC020066
• Gene Symbols: PDCD6IP
• Immunogen: PDCD6IP (AAH20066, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Apoptosis
• Gene ID (Entrez): 10015
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 3C4
• Description: Mouse monoclonal antibody raised against a partial recombinant PDCD6IP.
• Gene: PDCD6IP
• Gene Alias: AIP1/Alix/DRIP4/HP95/MGC17003
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody