pleckstrin homology domain containing, family M (with RUN domain) member 1, Mouse, Clone: 1C9, Abnova™

Catalog No.	Quantity
89-001-154	100 μg

Catalog No. 89-001-154 Supplier Abnova Corporation Supplier No. H00009842M01

Description

Mouse monoclonal antibody raised against a partial recombinant PLEKHM1.

The protein encoded by this gene is essential for bone resorption, and may play a critical role in vesicular transport in the osteoclast. Mutations in this gene are associated with autosomal recessive osteopetrosis type 6 (OPTB6). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq

Sequence: PHRFSVADLQQIADGVYEGFLKALIEFASQHVYHCDLCTQRGFICQICQHHDIIFPFEFDTTVRCAECKTVFHQSCQAVVKKGCPRCARRRKYQEQNIFA

Specifications

• Antigen: pleckstrin homology domain containing, family M (with RUN domain) member 1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1C9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PLEKHM1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PLEKHM1
• Gene Accession No.: BC064361
• Gene Alias: AP162/B2/KIAA0356/OPTB6
• Gene Symbols: PLEKHM1
• Host Species: Mouse
• Immunogen: PLEKHM1 (AAH64361, 957 a.a. ∼ 1056 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 9842
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ