protein phosphatase 1, regulatory (inhibitor) subunit 1C, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human PPP1R1C protein.

Supplier:  Abnova Corporation H00151242B01P

Catalog No. 89-016-627

Description

Sequence: MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH

Specifications

• Antigen: protein phosphatase 1, regulatory (inhibitor) subunit 1C
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human PPP1R1C protein.
• Gene: PPP1R1C
• Gene Alias: IPP5
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 151242
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: XM_087137.8
• Gene Symbols: PPP1R1C
• Immunogen: PPP1R1C (NP_001074014.1, 1 a.a. ∼ 109 a.a) full-length human protein.
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody