Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae), Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004600 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-600 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-600 Supplier Abnova Corporation Supplier No. H00027339A01
Only null left
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant PRPF19.

PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al., 2008 [PubMed 18263876]).[supplied by OMIM

Sequence: MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSF

Specifications

Antigen PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant PRPF19.
Formulation 50% glycerol
Gene PRPF19
Gene Accession No. NM_014502
Gene Alias NMP200/PRP19/PSO4/SNEV/UBOX4/hPSO4
Gene Symbols PRPF19
Host Species Mouse
Immunogen PRPF19 (NP_055317, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 27339
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.