proteasome (prosome, macropain) subunit, alpha type, 5, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PSMA5.

Supplier:  Abnova Corporation H00005686A01

Catalog No. 89-004-268

Description

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 nonidentical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a nonlysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. [provided by RefSeq

Sequence: AMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Specifications

• Antigen: proteasome (prosome, macropain) subunit, alpha type, 5
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PSMA5.
• Gene: PSMA5
• Gene Alias: MGC117302/MGC125802/MGC125803/MGC125804/PSC5/ZETA
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Stem Cell Biology
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_002790
• Gene Symbols: PSMA5
• Immunogen: PSMA5 (NP_002781, 132 a.a. ∼ 241 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 5686
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.