prostaglandin I2 (prostacyclin) synthase, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-270	50 μL

Catalog No. 89-004-270 Supplier Abnova Corporation Supplier No. H00005740A01

Description

Mouse polyclonal antibody raised against a partial recombinant PTGIS.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis. [provided by RefSeq

Sequence: PQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRP

Specifications

• Antigen: prostaglandin I2 (prostacyclin) synthase
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PTGIS.
• Formulation: 50% glycerol
• Gene: PTGIS
• Gene Accession No.: NM_000961
• Gene Alias: CYP8/CYP8A1/MGC126858/MGC126860/PGIS/PTGI
• Gene Symbols: PTGIS
• Host Species: Mouse
• Immunogen: PTGIS (NP_000952, 391 a.a. ∼ 500 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5740
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum