pleiotrophin, Mouse, Clone: 2E3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PTN.

Supplier:  Abnova Corporation H00005764M02

Catalog No. 89-000-922

Description

Sequence: SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESK

Specifications

• Antigen: pleiotrophin
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002825
• Gene Symbols: PTN
• Immunogen: PTN (NP_002816, 45 a.a. ∼ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 2E3
• Description: Mouse monoclonal antibody raised against a partial recombinant PTN.
• Gene: PTN
• Gene Alias: HARP/HBGF8/HBNF/NEGF1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 5764
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ