Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

pleiotrophin, Mouse, Clone: 2E3, Abnova™

Catalog No. 89000922 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-922 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-922 Supplier Abnova Corporation Supplier No. H00005764M02
Only null left
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant PTN.

Sequence: SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESK

Specifications

Antigen pleiotrophin
Applications ELISA, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 2E3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PTN.
Formulation PBS with no preservative; pH 7.4
Gene PTN
Gene Accession No. NM_002825
Gene Alias HARP/HBGF8/HBNF/NEGF1
Gene Symbols PTN
Host Species Mouse
Immunogen PTN (NP_002816, 45 a.a. ∼ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 5764
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.