regulatory factor X, 2 (influences HLA class II expression), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-282	50 μL

Catalog No. 89-004-282 Supplier Abnova Corporation Supplier No. H00005990A01

Description

Mouse polyclonal antibody raised against a partial recombinant RFX2.

This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. This protein can bind to cis elements in the promoter of the IL-5 receptor alpha gene. Two transcript variants encoding different isoforms have been described for this gene, and both variants utilize alternative polyadenylation sites. [provided by RefSeq

Sequence: PEQTMAVQSQHHQQYIDVSHVFPEFPAPDLGSFLLQDGVTLHDVKALQLVYRRHCEATVDVVMNLQFHYIEKLWLSFWNSKASSSDGPTSLPASDEDPEGAVLPKDK

Specifications

• Antigen: regulatory factor X, 2 (influences HLA class II expression)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RFX2.
• Formulation: 50% glycerol
• Gene: RFX2
• Gene Accession No.: NM_000635
• Gene Alias: FLJ14226
• Gene Symbols: RFX2
• Host Species: Mouse
• Immunogen: RFX2 (NP_000626, 323 a.a. ∼ 429 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5990
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum