regulator of G-protein signaling 19, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-485	50 μL

Catalog No. 89-004-485 Supplier Abnova Corporation Supplier No. H00010287A02

Description

Mouse polyclonal antibody raised against a partial recombinant RGS19.

G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq

Sequence: WNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKAR

Specifications

• Antigen: regulator of G-protein signaling 19
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RGS19.
• Formulation: 50% glycerol
• Gene: RGS19
• Gene Accession No.: NM_005873
• Gene Alias: GAIP/RGSGAIP
• Gene Symbols: RGS19
• Host Species: Mouse
• Immunogen: RGS19 (NP_005864, 51 a.a. ∼ 140 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 10287
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum