Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89018601

regulator of G-protein signaling 20, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No. 89018601 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-018-601 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-018-601 Supplier Abnova Corporation Supplier No. H00008601D01P
Only null left
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against a full-length human RGS20 protein.

Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi (see GNAI1; MIM 139310) and Gq (see GNAQ; MIM 600998) class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.[supplied by OMIM

Sequence: MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA

Specifications

Antigen regulator of G-protein signaling 20
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against a full-length human RGS20 protein.
Formulation PBS with no preservative; pH 7.4
Gene RGS20
Gene Accession No. NM_003702
Gene Alias RGSZ1/ZGAP1
Gene Symbols RGS20
Host Species Rabbit
Immunogen RGS20 (NP_003693.2, 1 a.a. ∼ 241 a.a) full-length human protein.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 8601
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.