ROBO2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ROBO2.

Supplier:  Abnova Corporation H00006092A01

Catalog No. 89-003-069

Description

This gene belongs to the ROBO family, part of the immunoglobulin superfamily proteins that are highly conserved from fly to human. The encoded protein is a receptor for SLIT2, molecules known to function in axon guidance and cell migration. Defects in this gene are the cause of vesicoureteral reflux type 2. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq

Sequence: ATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRISDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPSKPQVTDVTKNSVTL

Specifications

• Antigen: ROBO2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ROBO2.
• Gene: ROBO2
• Gene Alias: KIAA1568/SAX3
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_002942
• Gene Symbols: ROBO2
• Immunogen: ROBO2 (NP_002933, 441 a.a. ∼ 540 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 6092
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.