ribosomal protein S23, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-299	50 μL

Catalog No. 89-004-299 Supplier Abnova Corporation Supplier No. H00006228A01

Description

Mouse polyclonal antibody raised against a partial recombinant RPS23.

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S12P family of ribosomal proteins. It is located in the cytoplasm. The protein shares significant amino acid similarity with S. cerevisiae ribosomal protein S28. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq

Sequence: ASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS

Specifications

• Antigen: ribosomal protein S23
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RPS23.
• Formulation: 50% glycerol
• Gene: RPS23
• Gene Accession No.: NM_001025
• Gene Alias: FLJ35016
• Gene Symbols: RPS23
• Host Species: Mouse
• Immunogen: RPS23 (NP_001016, 44 a.a. ∼ 143 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6228
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum