ribosomal protein S23, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RPS23.

Manufacturer:  Abnova Corporation H00006228A01

Catalog No. 89-004-299

Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S12P family of ribosomal proteins. It is located in the cytoplasm. The protein shares significant amino acid similarity with S. cerevisiae ribosomal protein S28. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq

Sequence: ASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS

Specifications

• Antigen: ribosomal protein S23
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001025
• Gene Alias: FLJ35016
• Host Species: Mouse
• Quantity: 50 uL
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 6228

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant RPS23.
• Gene: RPS23
• Format: Serum
• Gene Symbols: RPS23
• Immunogen: RPS23 (NP_001016, 44 a.a. ~ 143 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human