ribosomal protein S6 kinase, 90kDa, polypeptide 3 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RPS6KA3.

Supplier:  Abnova Corporation H00006197A01

Catalog No. 89-004-294

Description

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Mutations in this gene have been associated with Coffin-Lowry syndrome (CLS). [provided by RefSeq

Sequence: PLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQ

Specifications

• Antigen: ribosomal protein S6 kinase, 90kDa, polypeptide 3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant RPS6KA3.
• Gene: RPS6KA3
• Gene Alias: CLS/HU-3/ISPK-1/MAPKAPK1B/MRX19/RSK/RSK2/S6K-alpha3/p90-RSK2/pp90RSK2
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004586
• Gene Symbols: RPS6KA3
• Immunogen: RPS6KA3 (NP_004577, 2 a.a. ∼ 95 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 6197
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.