rhotekin, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-300	50 μL

Catalog No. 89-004-300 Supplier Abnova Corporation Supplier No. H00006242A01

Description

Mouse polyclonal antibody raised against a partial recombinant RTKN.

This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: VTDILTQREGARLETPPPWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTWLQSP

Specifications

• Antigen: rhotekin
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RTKN.
• Formulation: 50% glycerol
• Gene: RTKN
• Gene Accession No.: NM_033046
• Gene Symbols: RTKN
• Host Species: Mouse
• Immunogen: RTKN (NP_149035, 451 a.a. ∼ 549 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6242
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum