RUNX1, Mouse, Clone: 3A8, Abnova™

Catalog No.	Quantity
89-016-449	100 μg

Catalog No. 89-016-449 Supplier Abnova Corporation Supplier No. H00000861M01

Description

Mouse monoclonal antibody raised against a partial recombinant RUNX1.

Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP

Specifications

• Antigen: RUNX1
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed)
• Classification: Monoclonal
• Clone: 3A8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RUNX1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RUNX1
• Gene Accession No.: NM_001001890
• Gene Alias: AML1/AML1-EVI-1/AMLCR1/CBFA2/EVI-1/PEBP2aB
• Gene Symbols: RUNX1
• Host Species: Mouse
• Immunogen: RUNX1 (NP_001001890.1, 210 a.a. ∼ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 861
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ