RUNX1, Mouse, Clone: 3A8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RUNX1.

Supplier:  Abnova Corporation H00000861M01

Catalog No. 89-016-449

Description

Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP

Specifications

• Antigen: RUNX1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001001890
• Gene Symbols: RUNX1
• Immunogen: RUNX1 (NP_001001890.1, 210 a.a. ∼ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed)
• Clone: 3A8
• Description: Mouse monoclonal antibody raised against a partial recombinant RUNX1.
• Gene: RUNX1
• Gene Alias: AML1/AML1-EVI-1/AMLCR1/CBFA2/EVI-1/PEBP2aB
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 861
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid