RUNX2, Mouse, Clone: 2B9, Abnova™

Catalog No.	Quantity
89-016-439	100 μg

Catalog No. 89-016-439 Supplier Abnova Corporation Supplier No. H00000860M02

Description

Mouse monoclonal antibody raised against a partial recombinant RUNX2.

This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. [provided by RefSeq

Sequence: NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA

Specifications

• Antigen: RUNX2
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 2B9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RUNX2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RUNX2
• Gene Accession No.: NM_004348
• Gene Alias: AML3/CBFA1/CCD/CCD1/MGC120022/MGC120023/OSF2/PEA2aA/PEBP2A1/PEBP2A2/PEBP2aA/PEBP2aA1
• Gene Symbols: RUNX2
• Host Species: Mouse
• Immunogen: RUNX2 (NP_004339, 251 a.a. ∼ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 860
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ