RUNX2, Mouse, Clone: 4B4, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant RUNX2.

Supplier:  Abnova Corporation H00000860M24

Catalog No. 89-016-448

Description

This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. [provided by RefSeq

Sequence: TSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTS

Specifications

• Antigen: RUNX2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001024630
• Gene Symbols: RUNX2
• Immunogen: RUNX2 (NP_001019801.1, 311 a.a. ∼ 450 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA, Western Blot
• Clone: 4B4
• Description: Mouse monoclonal antibody raised against a full length recombinant RUNX2.
• Gene: RUNX2
• Gene Alias: AML3/CBFA1/CCD/CCD1/MGC120022/MGC120023/OSF2/PEA2aA/PEBP2A1/PEBP2A2/PEBP2aA/PEBP2aA1
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 860
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid