Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RUNX2, Mouse, Clone: 4B4, Abnova™

Catalog No. 89016448 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-448 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-448 Supplier Abnova Corporation Supplier No. H00000860M24
Only null left
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant RUNX2.

This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. [provided by RefSeq

Sequence: TSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTS

Specifications

Antigen RUNX2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4B4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant RUNX2.
Formulation PBS with no preservative; pH 7.4
Gene RUNX2
Gene Accession No. NM_001024630
Gene Alias AML3/CBFA1/CCD/CCD1/MGC120022/MGC120023/OSF2/PEA2aA/PEBP2A1/PEBP2A2/PEBP2aA/PEBP2aA1
Gene Symbols RUNX2
Host Species Mouse
Immunogen RUNX2 (NP_001019801.1, 311 a.a. ∼ 450 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 860
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.