SEMA3A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-120	50 μL

Catalog No. 89-003-120 Supplier Abnova Corporation Supplier No. H00010371A01

Description

Mouse polyclonal antibody raised against a partial recombinant SEMA3A.

This gene is a member of the semaphorin family and encodes a protein with an Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a Sema domain. This secreted protein can function as either a chemorepulsive agent, inhibiting axonal outgrowth, or as a chemoattractive agent, stimulating the growth of apical dendrites. In both cases, the protein is vital for normal neuronal pattern development. Increased expression of this protein is associated with schizophrenia and is seen in a variety of human tumor cell lines. Also, aberrant release of this protein is associated with the progression of Alzheimer's disease. [provided by RefSeq]

Sequence: HLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRS

Specifications

• Antigen: SEMA3A
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SEMA3A.
• Formulation: 50% glycerol
• Gene: SEMA3A
• Gene Accession No.: NM_006080
• Gene Alias: Hsema-I/Hsema-III/MGC133243/SEMA1/SEMAD/SEMAIII/SEMAL/SemD/coll-1
• Gene Symbols: SEMA3A
• Host Species: Mouse
• Immunogen: SEMA3A (NP_006071, 672 a.a. ∼ 770 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10371
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid