selenoprotein X, 1, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-491	100 μg

Catalog No. 89-018-491 Supplier Abnova Corporation Supplier No. H00051734D01P

Description

Rabbit polyclonal antibody raised against a full-length human SEPX1 protein.

This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein belongs to the methionine sulfoxide reductase B (MsrB) family, and it is expressed in a variety of adult and fetal tissues. [provided by RefSeq]

Sequence: MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRF

Specifications

• Antigen: selenoprotein X, 1
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human SEPX1 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SEPX1
• Gene Accession No.: NM_016332.2
• Gene Alias: HSPC270/MGC3344/MSRB1/SELR/SELX
• Gene Symbols: SEPX1
• Host Species: Rabbit
• Immunogen: SEPX1 (NP_057416.1, 1 a.a. ∼ 94 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 51734
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG