Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

solute carrier family 2 (facilitated glucose transporter), member 9, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SLC2A9.

Manufacturer:  Abnova Corporation H00056606A01

Catalog No. 89-004-684


Add to cart

Description

Description

This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: PDSPRYLLLEKHNEARAVKAFQTFLGKADVSQEVEEVLAESRVQRSIRLVSVLELLRAPYVRWQ
Specifications

Specifications

solute carrier family 2 (facilitated glucose transporter), member 9
Unconjugated
50% glycerol
NM_001001290
GLUT9|GLUTX|UAQTL2|URATv1
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
56606
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant SLC2A9.
SLC2A9
Serum
SLC2A9
SLC2A9 (NP_001001290, 224 a.a. ~ 287 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit