Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004562

solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004562 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
Catalog No. Quantity
89-004-562 50 μL
1 options

Catalog No. 89-004-562

Supplier: Abnova Corporation H00023443A01

Only null left
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant SLC35A3.

Sequence: DSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATY

Specifications

Antigen solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant SLC35A3.
Formulation 50% glycerol
Gene SLC35A3
Gene Accession No. NM_012243
Gene Alias DKFZp781P1297
Gene Symbols SLC35A3
Host Species Mouse
Immunogen SLC35A3 (NP_036375, 61 a.a. ∼ 113 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 23443
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.