syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-006-265	50 μL

Catalog No. 89-006-265 Supplier Abnova Corporation Supplier No. H00006645B01

Description

Mouse polyclonal antibody raised against a full-length human SNTB2 protein.

Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes. [provided by RefSeq

Sequence: MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELEPALGPAAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRQN

Specifications

• Antigen: syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2)
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human SNTB2 protein.
• Formulation: No additive
• Gene: SNTB2
• Gene Accession No.: ENST00000360496
• Gene Alias: D16S2531E/EST25263/SNT2B2/SNT3/SNTL
• Gene Symbols: SNTB2
• Host Species: Mouse
• Immunogen: SNTB2 (ENSP00000353686, 1 a.a. ∼ 267 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6645
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum