syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human SNTB2 protein.

Supplier:  Abnova Corporation H00006645B01

Catalog No. 89-006-265

Description

Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes. [provided by RefSeq

Sequence: MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELEPALGPAAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRQN

Specifications

• Antigen: syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human SNTB2 protein.
• Gene: SNTB2
• Gene Alias: D16S2531E/EST25263/SNT2B2/SNT3/SNTL
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 6645
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: ENST00000360496
• Gene Symbols: SNTB2
• Immunogen: SNTB2 (ENSP00000353686, 1 a.a. ∼ 267 a.a) full-length human protein.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum