SRY (sex determining region Y)-box 12, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-320	50 μL

Catalog No. 89-004-320 Supplier Abnova Corporation Supplier No. H00006666A01

Description

Mouse polyclonal antibody raised against a partial recombinant SOX12.

Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types. [provided by RefSeq

Sequence: LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF

Specifications

• Antigen: SRY (sex determining region Y)-box 12
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SOX12.
• Formulation: 50% glycerol
• Gene: SOX12
• Gene Accession No.: NM_006943
• Gene Alias: SOX22
• Gene Symbols: SOX12
• Host Species: Mouse
• Immunogen: SOX12 (NP_008874, 252 a.a. ∼ 313 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6666
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum