TAR DNA binding protein, Mouse, Clone: 2E2-D3, Abnova™

Catalog No.	Quantity
89-014-287	100 μg

Catalog No. 89-014-287 Supplier Abnova Corporation Supplier No. H00023435M01

Description

Mouse monoclonal antibody raised against a partial recombinant TARDBP.

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq

Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA

Specifications

• Antigen: TAR DNA binding protein
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Immunoprecipitation, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 2E2-D3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TARDBP.
• Formulation: In 1X PBS, pH 7.4
• Gene: TARDBP
• Gene Accession No.: NM_007375.3
• Gene Alias: ALS10/TDP-43
• Gene Symbols: TARDBP
• Host Species: Mouse
• Immunogen: TARDBP (NP_031401.1, 1 a.a. ∼ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 23435
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ