transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A), Mouse, Clone: 1F3, Abnova™

Catalog No.	Quantity
89-001-002	100 μg

Catalog No. 89-001-002 Supplier Abnova Corporation Supplier No. H00006924M02

Description

Mouse monoclonal antibody raised against a partial recombinant TCEB3.

This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. [provided by RefSeq

Sequence: NAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMY

Specifications

• Antigen: transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A)
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1F3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TCEB3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TCEB3
• Gene Accession No.: NM_003198
• Gene Alias: FLJ38760/FLJ42849/SIII/TCEB3A
• Gene Symbols: TCEB3
• Host Species: Mouse
• Immunogen: TCEB3 (NP_003189, 81 a.a. ∼ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6924
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ