transcription factor Dp family, member 3, Mouse, Clone: 3F11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TFDP3.

Supplier:  Abnova Corporation H00051270M02

Catalog No. 89-001-279

Description

TFDP3 is a member of the DP family of proteins, which form heterodimers with E2F proteins (see E2F1; MIM 189971) and regulate transcription (Qiao et al., 2007 [PubMed 17062573]).[supplied by OMIM

Sequence: MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNI

Specifications

• Antigen: transcription factor Dp family, member 3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_016521
• Gene Symbols: TFDP3
• Immunogen: TFDP3 (NP_057605, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 51270
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 3F11
• Description: Mouse monoclonal antibody raised against a partial recombinant TFDP3.
• Gene: TFDP3
• Gene Alias: CT30/E2F-like/HCA661/MGC161639
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody