Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001279

transcription factor Dp family, member 3, Mouse, Clone: 3F11, Abnova™

Catalog No. 89001279 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-279 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-279 Supplier Abnova Corporation Supplier No. H00051270M02
Only null left
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant TFDP3.

TFDP3 is a member of the DP family of proteins, which form heterodimers with E2F proteins (see E2F1; MIM 189971) and regulate transcription (Qiao et al., 2007 [PubMed 17062573]).[supplied by OMIM

Sequence: MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNI

Specifications

Antigen transcription factor Dp family, member 3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3F11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant TFDP3.
Formulation PBS with no preservative; pH 7.4
Gene TFDP3
Gene Accession No. NM_016521
Gene Alias CT30/E2F-like/HCA661/MGC161639
Gene Symbols TFDP3
Host Species Mouse
Immunogen TFDP3 (NP_057605, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 51270
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.