TMOD2 (B02P), Mouse anti-Human, Rat, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human TMOD2 protein.

Supplier:  Abnova Corporation H00029767B02P

Catalog No. 89-002-844

Description

This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq

Sequence: MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALETNTHVKKFSLAATRSNDPVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTETKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRR

Specifications

• Antigen: TMOD2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human TMOD2 protein.
• Gene: TMOD2
• Gene Alias: MGC39481/N-TMOD/NTMOD
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 29767
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC064961
• Gene Symbols: TMOD2
• Immunogen: TMOD2 (AAH64961, 1 a.a. ∼ 351 a.a) full-length human protein.
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG