Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001221

TRAF2 and NCK interacting kinase, Mouse, Clone: 4E4, Abnova™

Catalog No. 89001221 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-221 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-221 Supplier Abnova Corporation Supplier No. H00023043M02
Only null left
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant TNIK.

Germinal center kinases (GCKs), such as TNIK, are characterized by an N-terminal kinase domain and a C-terminal GCK domain that serves a regulatory function (Fu et al., 1999 [PubMed 10521462]).[supplied by OMIM

Sequence: MKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDL

Specifications

Antigen TRAF2 and NCK interacting kinase
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 4E4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant TNIK.
Formulation PBS with no preservative; pH 7.4
Gene TNIK
Gene Accession No. BC055427
Gene Symbols TNIK
Host Species Mouse
Immunogen TNIK (AAH55427, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 23043
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.