TSC22 domain family, member 3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TSC22D3.

Supplier:  Abnova Corporation H00001831A01

Catalog No. 89-004-103

Description

The protein encoded by this gene shares significant sequence identity with the murine TSC-22 and Drosophila shs, both of which are leucine zipper proteins, that function as transcriptional regulators. The expression of this gene is stimulated by glucocorticoids and interleukin 10, and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid and chemokine. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq

Sequence: MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT

Specifications

• Antigen: TSC22 domain family, member 3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant TSC22D3.
• Gene: TSC22D3
• Gene Alias: DIP/DKFZp313A1123/DSIPI/GILZ/TSC-22R/hDIP
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_198057
• Gene Symbols: TSC22D3
• Immunogen: TSC22D3 (NP_932174, 1 a.a. ∼ 97 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 1831
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.