ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-358	50 μL

Catalog No. 89-004-358 Supplier Abnova Corporation Supplier No. H00007322A01

Description

Mouse polyclonal antibody raised against a partial recombinant UBE2D2.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. [provided by RefSeq

Sequence: MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWS

Specifications

• Antigen: ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant UBE2D2.
• Formulation: 50% glycerol
• Gene: UBE2D2
• Gene Accession No.: NM_003339
• Gene Alias: E2(17)KB2/PUBC1/UBC4/UBC4/5/UBCH5B
• Gene Symbols: UBE2D2
• Host Species: Mouse
• Immunogen: UBE2D2 (NP_003330, 1 a.a. ∼ 94 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Ubiquitin/Proteasome
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7322
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum