VAPB, Rabbit, MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human VAPB protein.

Supplier:  Abnova Corporation H00009217D01

Catalog No. 89-002-919

Description

The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking. [provided by RefSeq

Sequence: MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL

Specifications

• Antigen: VAPB
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human VAPB protein.
• Gene: VAPB
• Gene Alias: ALS8/VAMP-B/VAMP-C/VAP-B/VAP-C
• Host Species: Rabbit
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Liquid

• Applications: Immunoprecipitation, Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_004738.3
• Gene Symbols: VAPB
• Immunogen: VAPB (NP_004729.1, 1 a.a. ∼ 243 a.a) full-length human protein.
• Regulatory Status: RUO
• Gene ID (Entrez): 9217
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.