Y box binding protein 1, Mouse, Clone: 4C7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant YBX1.

Supplier:  Abnova Corporation H00004904M02

Catalog No. 89-000-848

Description

Sequence: DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA

Specifications

• Antigen: Y box binding protein 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004559
• Gene Symbols: YBX1
• Immunogen: YBX1 (NP_004550, 51 a.a. ∼ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Stem Cell Biology
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 4C7
• Description: Mouse monoclonal antibody raised against a partial recombinant YBX1.
• Gene: YBX1
• Gene Alias: BP-8/CSDA2/CSDB/DBPB/MDR-NF1/MGC104858/MGC110976/MGC117250/NSEP-1/NSEP1/YB-1/YB1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 4904
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ