sterile alpha motif and leucine zipper containing kinase AZK, Mouse, Clone: 1D5, Abnova™

Catalog No.	Quantity
89-001-290	100 μg

Catalog No. 89-001-290 Supplier Abnova Corporation Supplier No. H00051776M08

Description

Mouse monoclonal antibody raised against a partial recombinant ZAK.

This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY

Specifications

• Antigen: sterile alpha motif and leucine zipper containing kinase AZK
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1D5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ZAK.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ZAK
• Gene Accession No.: BC001401
• Gene Alias: AZK/MLK7/MLT/MLTK/MRK/mlklak
• Gene Symbols: ZAK
• Host Species: Mouse
• Immunogen: ZAK (AAH01401, 1 a.a. ∼ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 51776
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ