Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

zinc finger protein 622 (A01), Mouse anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ZNF622.

Manufacturer:  Abnova Corporation H00090441A01

Catalog No. 89-004-757


Add to cart

Description

Description

Sequence: MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQ
Specifications

Specifications

zinc finger protein 622
Unconjugated
50% glycerol
NM_033414
MGC17552|MGC2485|ZPR9
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
90441
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant ZNF622.
ZNF622
Serum
ZNF622
ZNF622 (NP_219482, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Murine, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit