Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Apc1 Antibody, R&D Systems™

Apc1 Antibody, R&D Systems™
SDP

Catalog No. NBP237880
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP237880 0.1 mL
NB436386 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP237880 Supplier R&D Systems Supplier No. NBP237880

Customers require a valid business account associated to their profile to access pricing and ordering options.

missing translation for 'validMainframeMsg'

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Apc1 Polyclonal specifically detects Apc1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

Antigen Apc1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9H1A4
Gene Alias anaphase promoting complex subunit 1, anaphase-promoting complex 1 (meiotic checkpoint regulator), anaphase-promoting complex subunit 1, APC1Testis-specific gene 24 protein, Cyclosome subunit 1, Mitotic checkpoint regulator, TSG24MCPR
Gene Symbols ANAPC1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SNSNGSFLAPETEPIVPELCIDHLWTETITNIREKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAAPVE
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64682
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Isotype IgG
Product Line Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.