Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific APEL001A

Encompass

Orphan G protein-coupled receptor shown to be a coreceptor for simian and human immunodeficiency virus (SIV and HIV) strains. As long as apelin is an endogenous ligand for the APJ receptor, inhibitory effects of apelin peptides on HIV infection have been found to display that apelin peptides inhibit the entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. Strong inhibitory efficiency.ONE-LETTER SEQUENCE: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPFMOLECULAR FORMULA: C184H297N69O43S1MOLECULAR WEIGHT:4195.89STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [252642-12-9], SYNONYMS: Apelin-36 (human)RESEARCH AREA: Antimicrobial

Catalog No. 50-210-8778


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.