Learn More
CPC Scientific H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH (trifluoroacetate salt) 0.5MG

Supplier: CPC Scientific APEL001A

Orphan G protein-coupled receptor shown to be a coreceptor for simian and human immunodeficiency virus (SIV and HIV) strains. As long as apelin is an endogenous ligand for the APJ receptor, inhibitory effects of apelin peptides on HIV infection have been found to display that apelin peptides inhibit the entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. Strong inhibitory efficiency.ONE-LETTER SEQUENCE: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPFMOLECULAR FORMULA: C184H297N69O43S1MOLECULAR WEIGHT:4195.89STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [252642-12-9], SYNONYMS: Apelin-36 (human)RESEARCH AREA: Antimicrobial
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.