Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578806

Invitrogen™ Aquaporin 1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578806 Shop All Thermo Scientific Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578806 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578806 Supplier Invitrogen™ Supplier No. PA578806
  • $553.00
    $421.65 / Each of 1

    Save $131.35

    24% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Edge
Add to Cart

missing translation for 'validMainframeMsg'

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat heart tissue, rat kidney tissue, rat lung tissue, mouse heart tissue, mouse kidney tissue, mouse lung tissue. IHC: human kidney tissue, mouse kidney tissue, rat kidney tissue. Flow: U2OS cell.

Aquaporin 1 is a 28kD integral membrane protein which was originally identified in red blood cells and renal proximal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Aquaporin 1
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene Aqp1
Gene Accession No. P29972, P29975, Q02013
Gene Alias AQP 1; AQP CHIP; Aqp1; AQP-1; AQP-CHIP; aquaporin 1; Aquaporin 1 (aquaporin channel forming integral protein 28 (CHIP)); aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group); aquaporin 1 (Colton blood group); aquaporin 1, Colton blood group antigen; Aquaporin CHIP; Aquaporin1; aquaporin-1; Aquaporin-CHIP; channel-like integral membrane protein, 28-kDa; CHIP 28; CHIP28; CO; Colton blood group; Delayed early response protein 2; DER2; growth factor-induced delayed early response protein; membrane channel; MGC26324; urine water channel; Water channel protein for red blood cells and kidney proximal tubule
Gene Symbols Aqp1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11826, 25240, 358
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.