Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578821

Invitrogen™ ARHGEF1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578821
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578821 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578821 Supplier Invitrogen™ Supplier No. PA578821
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, HELA whole cell, JURKAT whole cell. IHC: mouse lymphaden tissue, rat lymphaden tissue. ICC/IF: A431 cell. Flow: A431 cell.

The Ras superfamily of GTPases, which can be subdivided into the Ras, Rho/Rac, Sar, Rab, ARF and Ran subfamilies, controls multiple aspects of cell function, including cytoskeletal rearrangement, nuclear signaling and cell growth. The Ras superfamily of GTPases function as regulated switches that toggle between a biologically active GTP-bound and an inactive GDP-bound form. This activation is catalyzed by guanine nucleotide exchange factors (GEFs). The Dbl-related proteins are a large family of structurally related molecules that have a common ability to catalyze GEF activity for specific members of the Ras family. Dbl-related proteins include FGD1, Lsc, RhoGEF p115, Lfc, Lbc and Brx. Lsc, Lbc and Lfc share sequence homology and show exchange activity toward Rho family GTPases. RhoGEF p115 catalyzes GEF activity for Rho but not Rac, Cdc42 or Ras GTPases.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ARHGEF1
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Arhgef1
Gene Accession No. Q61210, Q92888, Q9Z1I6
Gene Alias 115 kDa guanine nucleotide exchange factor; 115-kD protein; ARHGEF1; GEF1; LBCL2; Lbc's second cousin; Lsc; Lsc homolog; lymphoid blast crisis like 2; lymphoid blast crisis-like 2; p115RhoGEF; p115-RhoGEF; Rho guanine nucleotide exchange factor (GEF) 1; Rho guanine nucleotide exchange factor 1; Sub1.5
Gene Symbols Arhgef1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ARHGEF1 (41-71aa EQNSQFQSLEQVKRRPAHLMALLQHVALQFE).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 16801, 60323, 9138
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.