Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578846

Invitrogen™ Ataxin 2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578846
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578846 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578846 Supplier Invitrogen™ Supplier No. PA578846
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human K562 whole cell, human A549 whole cell, rat brain tissue, mouse brain tissue, mouse liver tissue. IHC: human breast cancer tissue, human colonic adenoma cancer tissue, human glioma tissue, human placenta tissue.

The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. Defects in this gene are the cause of spinocerebellar ataxia type 2 (SCA2). SCA2 belongs to the autosomal dominant cerebellar ataxias type I (ADCA I) which are characterized by cerebellar ataxia in combination with additional clinical features like optic atrophy, ophthalmoplegia, bulbar and extrapyramidal signs, peripheral neuropathy and dementia. SCA2 is caused by expansion of a CAG repeat in the coding region of this gene. Longer expansions result in earlier onset of the disease. Alternatively spliced transcript variants encoding different isoforms have been identified but their full length sequence has not been determined.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Ataxin 2
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene Atxn2
Gene Accession No. O70305, Q99700
Gene Alias 9630045M23Rik; ASL13; ataxin 2; ataxin-2; ATX2; Atxn2; AW544490; FLJ46772; SCA2; spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant, ataxin 2); spinocerebellar ataxia 2 homolog; spinocerebellar ataxia type 2 protein; Spinocerebellar ataxia type 2 protein homolog; TNRC13; Trinucleotide repeat-containing gene 13 protein
Gene Symbols Atxn2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human ATX2 (1283-1313aa QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 20239, 288663, 6311
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.