Invitrogen™ Ataxin 2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578846

Catalog No. PIPA578846

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human K562 whole cell, human A549 whole cell, rat brain tissue, mouse brain tissue, mouse liver tissue. IHC: human breast cancer tissue, human colonic adenoma cancer tissue, human glioma tissue, human placenta tissue.

The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. Defects in this gene are the cause of spinocerebellar ataxia type 2 (SCA2). SCA2 belongs to the autosomal dominant cerebellar ataxias type I (ADCA I) which are characterized by cerebellar ataxia in combination with additional clinical features like optic atrophy, ophthalmoplegia, bulbar and extrapyramidal signs, peripheral neuropathy and dementia. SCA2 is caused by expansion of a CAG repeat in the coding region of this gene. Longer expansions result in earlier onset of the disease. Alternatively spliced transcript variants encoding different isoforms have been identified but their full length sequence has not been determined.

Specifications

• Antigen: Ataxin 2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Atxn2
• Gene Alias: 9630045M23Rik; ASL13; ataxin 2; ataxin-2; ATX2; Atxn2; AW544490; FLJ46772; SCA2; spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant, ataxin 2); spinocerebellar ataxia 2 homolog; spinocerebellar ataxia type 2 protein; Spinocerebellar ataxia type 2 protein homolog; TNRC13; Trinucleotide repeat-containing gene 13 protein
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 20239, 288663, 6311
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: O70305, Q99700
• Gene Symbols: Atxn2
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ATX2 (1283-1313aa QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov