Invitrogen™ ATP11C Polyclonal Antibody

Catalog No.	Quantity
PIPA5143956	100 μg

Catalog No. PIPA5143956 Supplier Invitrogen™ Supplier No. PA5143956

Description

Rabbit Polyclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human HEK293 whole cell, human K562 whole cell, human PC-3 whole cell, human Hela whole cell, human A549 whole cell. ICC/IF: U20S cell. Flow: A549 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The ATP11C gene encodes a protein that belongs to the P4-ATPase family, specifically functioning as a phospholipid-transporting ATPase. ATP11C plays a critical role in the maintenance of phospholipid asymmetry across the cell membrane by transporting aminophospholipids from the outer leaflet to the inner leaflet of the plasma membrane. This activity is essential for various biological processes, including cell membrane integrity, cell signaling, and apoptosis. ATP11C is particularly important in hematopoiesis, influencing the development of B cells and red blood cells. Mutations or dysregulation in ATP11C can lead to disruptions in cell membrane dynamics and are associated with immunological disorders and anemia. Research on ATP11C continues to focus on its role in phospholipid transport and its implications for cellular function and disease, particularly in the context of blood-related disorders.

Specifications

• Antigen: ATP11C
• Applications: Flow Cytometry, Western Blot, Immunocytochemistry
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: Atp11c
• Gene Accession No.: Q8NB49
• Gene Alias: A330005H02Rik; AI315324; Atp11c; Atpase 11c, p type; ATPase class VI type 11C; ATPase IQ; ATPase phospholipid transporting 11C; ATPase, class VI, type 11C; ATPIG; ATPIQ; I79_007666; Ig; P4-ATPase flippase complex alpha subunit ATP11C; phospholipid-transporting ATPase 11C; Phospholipid-transporting ATPase IG; probable phospholipid-transporting ATPase 11C; probable phospholipid-transporting ATPase IG; putative phospholipid-transporting ATPase 11C
• Gene Symbols: Atp11c
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence of human ATP11C (QNHEIELTKVHVERNAMDGYRTLCVAFKEIAPDDYER).
• Purification Method: Antigen affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 286410
• Target Species: Human
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG