Invitrogen™ ATP11C Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA5143956

Catalog No. PIPA5143956

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human HEK293 whole cell, human K562 whole cell, human PC-3 whole cell, human Hela whole cell, human A549 whole cell. ICC/IF: U20S cell. Flow: A549 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The ATP11C gene encodes a protein that belongs to the P4-ATPase family, specifically functioning as a phospholipid-transporting ATPase. ATP11C plays a critical role in the maintenance of phospholipid asymmetry across the cell membrane by transporting aminophospholipids from the outer leaflet to the inner leaflet of the plasma membrane. This activity is essential for various biological processes, including cell membrane integrity, cell signaling, and apoptosis. ATP11C is particularly important in hematopoiesis, influencing the development of B cells and red blood cells. Mutations or dysregulation in ATP11C can lead to disruptions in cell membrane dynamics and are associated with immunological disorders and anemia. Research on ATP11C continues to focus on its role in phospholipid transport and its implications for cellular function and disease, particularly in the context of blood-related disorders.

Specifications

• Antigen: ATP11C
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Atp11c
• Gene Alias: A330005H02Rik; AI315324; Atp11c; Atpase 11c, p type; ATPase class VI type 11C; ATPase IQ; ATPase phospholipid transporting 11C; ATPase, class VI, type 11C; ATPIG; ATPIQ; I79_007666; Ig; P4-ATPase flippase complex alpha subunit ATP11C; phospholipid-transporting ATPase 11C; Phospholipid-transporting ATPase IG; probable phospholipid-transporting ATPase 11C; probable phospholipid-transporting ATPase IG; putative phospholipid-transporting ATPase 11C
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 286410
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: Q8NB49
• Gene Symbols: Atp11c
• Immunogen: A synthetic peptide corresponding to a sequence of human ATP11C (QNHEIELTKVHVERNAMDGYRTLCVAFKEIAPDDYER).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG