Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502532724

Kingfisher Biotech Inc Bat IFN Lambda 3 Recombinant Protein
SDP

Supplier:  Kingfisher Biotech Inc RP1828BT025

Encompass_Preferred

The Common Vampire Bat IFN lambda 3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Common Vampire Bat IFN lambda 3 applications are for cell culture, ELISA standard, and Western Blot Control. Common Vampire Bat IFN lambda 3 yeast-derived recombinant protein can be purchased in multiple sizes. Common Vampire Bat IFN lambda 3 Specifications: (Molecular Weight: 23.4 kDa) (Amino Acid Sequence: PPPLLTLSMP SLVSPSINTD LPVGCTLVLM LMTTVLTRTA AVPVPTPLSA LPGARGCVVA QFKFLAPQDMKAFRRAKDTLEELLLPKNRSCSSRPFPRTRDLRQLQVWERPVALEAELALTLKVLGSIANSTLGDILDQPLHMLRYIHTKLQACVPAQATAGPRPRGHLHHWLHRLQEASKKESTGCLEASVTFNLFRLLTHDLQCVASGGLCI (214)) (Gene ID: 112320026). For research use only. Made in the USA

Catalog No. 50-253-2724


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.