Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. NC0904817

AnaSpec Beta - Amyloid (1 - 40), HiLyteᵀᴹ Fluor 647 - labeled, Human, 0.1mg

Supplier:  AnaSpec AS60493

Encompass

Sequence: HiLyte™ Fluor 647-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Molecular Weight 5315.4, Beta - Amyloid (1 - 40), HiLyteᵀᴹ Fluor 647 - labeled, Human, 0.1mg

Catalog No. NC0904817


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.