Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-OH (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific AMYD023A

Encompass

Similar to the beta-amyloid protein fragment (25-35), the fragment (1-38) destabilizes calcium homeostasis and makes neurons vulnerable to environmental insults.ONE-LETTER SEQUENCE: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGMOLECULAR FORMULA: C184H277N51O56S1MOLECULAR WEIGHT:4131.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [131438-74-9], SYNONYMS: Amyloid β-Protein (1-38)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: M.P. Mattson, J. Neurosci., 12, 376 (1992)

Catalog No. 50-210-8674


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.