Learn More
CPC Scientific H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-OH (trifluoroacetate salt) 0.5MG

Supplier: CPC Scientific AMYD023A

Similar to the beta-amyloid protein fragment (25-35), the fragment (1-38) destabilizes calcium homeostasis and makes neurons vulnerable to environmental insults.ONE-LETTER SEQUENCE: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGMOLECULAR FORMULA: C184H277N51O56S1MOLECULAR WEIGHT:4131.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [131438-74-9], SYNONYMS: Amyloid β-Protein (1-38)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: M.P. Mattson, J. Neurosci., 12, 376 (1992)
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.