Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. NC0956788

AnaSpec Beta - Amyloid Peptide (1 - 42), mouse, rat, 0.5mg

Supplier:  AnaSpec AS25381

Encompass

Beta - Amyloid Peptide (1 - 42), mouse, rat, 0.5mg, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Molecular Weight 4418,

Catalog No. NC0956788


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.