Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109189

CPC Scientific H-Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys-OH (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific DEFS003B

Encompass

SEQUENCE: H-Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys-OH (trifluoroacetate salt)(Cys5 and 34 bridge, Cys12 and 27 bridge, Cys17 and 35 bridge)ONE-LETTER SEQUENCE: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (C5&C34 bridge, C12&C27 bridge, C17&C35 bridge)MOLECULAR FORMULA: C167H256N48O50S6MOLECULAR WEIGHT: 3928.6STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: SYNONYMS: -Defensin-1, humanRESEARCH AREA: AntimicrobialREFERENCES:K.W. Bensch, M. Raida, H-J. M?gert, P. Schulz-Knappe, and W.-G. Forssmann, FEBS Lett., 368, 331 (1995). (Original Article)R.I. Lehrer and T. Ganz, Ann. N.Y. Acad. Sci., 797, 228 (1996). (Review Article)SKU(s): DEFS-003A, DEFS-003B

Catalog No. 50-210-9189


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.