Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA580198

Invitrogen™ beta-5 Tubulin Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA580198
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA580198 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA580198 Supplier Invitrogen™ Supplier No. PA580198
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human SiHa whole cell, human 293T whole cell, human HepG2 whole cell, monkey COS-7 whole cell, chicken heart tissue, rat brain tissue, rat PC-12 whole cell, mouse brain tissue, mouse NIH/3T3 whole cell. IHC: human liver cancer tissue, human testicular germ cell tumor tissue. ICC/IF: U20S cell. Flow: SiHa cell.

Microtubules, the major cytoskeletal elements found in all eukaryotic cells, consist of Tublin, which is a dimer of two 55kDa subunits: alpha and Beta. Microtubules play key roles in chromosome segregation in mitosis, intracellular transport, ciliary and flagellar bending, and structural support of the cytoskeleton. This antibody does not cause the 10-nm filaments to collapse into large lateral aggregates collecting in the cell periphery or tight juxtanuclear caps. It does not block microtubule assembly. Ab-3 does not inhibit polymerization or depolymerization of platelet tubulin in vitro. It blocks (by 70-80%) the ability of tubulin dimers (with GppNHp bound) to promote a stable inhibition of adenylyl cyclase.
TRUSTED_SUSTAINABILITY

Specifications

Antigen beta-5 Tubulin
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry, Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene TUBB
Gene Accession No. P07437, P09244, P69897, P99024
Gene Alias AA408537; AI596182; B130022C14Rik; beta Ib tubulin; CDCBM6; CSCSC1; M(beta)5; M40; OK/SW-cl.56; tbb5; TUBB; TUBB1; TUBB5; tubulin beta; Tubulin beta chain; tubulin beta class I; tubulin beta-1 chain; tubulin beta-5 chain; tubulin, beta 5 class I; tubulin, beta class I; tubulin, beta polypeptide
Gene Symbols TUBB, Tubb5
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 203068, 22154, 29214, 396254
Target Species Human, Mouse, Rat, Monkey, Chicken
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.